ENDOD1 polyclonal antibody
  • ENDOD1 polyclonal antibody

ENDOD1 polyclonal antibody

Ref: AB-PAB20498
ENDOD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ENDOD1.
Información adicional
Size 100 uL
Gene Name ENDOD1
Gene Alias KIAA0830|MGC88092
Gene Description endonuclease domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GECDKFFYAGTPPAGLAADSHVKICQRAEGAERFATLYSTRDRIPVYSAFRAPRPAPGGAEQRWLVEPQIDDPNSNLEEAINEAEAITSVNSLGSKQALNTDYLDSDYQRGQLYPFSLSSDVQVATFTLTNSAPMTQSF
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ENDOD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23052
Iso type IgG

Enviar uma mensagem


ENDOD1 polyclonal antibody

ENDOD1 polyclonal antibody