HILPDA polyclonal antibody
  • HILPDA polyclonal antibody

HILPDA polyclonal antibody

Ref: AB-PAB20497
HILPDA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HILPDA.
Información adicional
Size 100 uL
Gene Name HILPDA
Gene Alias C7orf68|HIG-2|HIG2
Gene Description hypoxia inducible lipid droplet-associated
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HILPDA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29923
Iso type IgG

Enviar uma mensagem


HILPDA polyclonal antibody

HILPDA polyclonal antibody