IER3IP1 polyclonal antibody
  • IER3IP1 polyclonal antibody

IER3IP1 polyclonal antibody

Ref: AB-PAB20493
IER3IP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IER3IP1.
Información adicional
Size 100 uL
Gene Name IER3IP1
Gene Alias HSPC039|PRO2309
Gene Description immediate early response 3 interacting protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key ICC
Immunogen Prot. Seq IAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRT
Form Liquid
Recomended Dilution Immunocytochemistry
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IER3IP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51124
Iso type IgG

Enviar uma mensagem


IER3IP1 polyclonal antibody

IER3IP1 polyclonal antibody