Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ALDH1A2 polyclonal antibody
Abnova
ALDH1A2 polyclonal antibody
Ref: AB-PAB20491
ALDH1A2 polyclonal antibody
Contacte-nos
Información del producto
Rabbit polyclonal antibody raised against recombinant ALDH1A2.
Información adicional
Size
100 uL
Gene Name
ALDH1A2
Gene Alias
MGC26444|RALDH(II)|RALDH2|RALDH2-T
Gene Description
aldehyde dehydrogenase 1 family, member A2
Storage Conditions
Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key
WB,IHC-P
Immunogen Prot. Seq
VVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTV
Form
Liquid
Recomended Dilution
Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species
Human
Immunogen
Recombinant protein corresponding to amino acids of human ALDH1A2.
Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID
8854
Iso type
IgG
Enviar uma mensagem
ALDH1A2 polyclonal antibody
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*