KIAA0574 polyclonal antibody
  • KIAA0574 polyclonal antibody

KIAA0574 polyclonal antibody

Ref: AB-PAB20483
KIAA0574 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA0574.
Información adicional
Size 100 uL
Gene Name KIAA0574
Gene Alias FLJ61121
Gene Description KIAA0574 protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PGMGSQVQPGPGHVSRSTSDPTLCTSSMAGDASSHRPSCSQDLEAGLSEAVPGSASMSRSATAACRAQLSPAGDPDTWKTDQRPTPEPFPATSKERPRSLVDSKAYADARV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA0574.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23359
Iso type IgG

Enviar uma mensagem


KIAA0574 polyclonal antibody

KIAA0574 polyclonal antibody