TTC14 polyclonal antibody
  • TTC14 polyclonal antibody

TTC14 polyclonal antibody

Ref: AB-PAB20481
TTC14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TTC14.
Información adicional
Size 100 uL
Gene Name TTC14
Gene Alias DKFZp313M1015|DRDL5813|FLJ00166|KIAA1980|PRO19630
Gene Description tetratricopeptide repeat domain 14
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SNPPSLMRGLQSKNFSEDDFASALRKKQSASWALKCVKIGVDYFKVGRHVDAMNEYNKALEIDKQNVEALVARGALYATKGSLNKAIEDFELALENCPTHRNARKYLCQTLVERGGQLEEEEKFLNAESYYKKALALDET
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TTC14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 151613
Iso type IgG

Enviar uma mensagem


TTC14 polyclonal antibody

TTC14 polyclonal antibody