PNPLA7 polyclonal antibody
  • PNPLA7 polyclonal antibody

PNPLA7 polyclonal antibody

Ref: AB-PAB20475
PNPLA7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PNPLA7.
Información adicional
Size 100 uL
Gene Name PNPLA7
Gene Alias C9orf111|FLJ31318|FLJ43070|FLJ44279|NTE-R1|NTEL1|RP11-48C7.2
Gene Description patatin-like phospholipase domain containing 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CEVGYQHGRTVFDIWGRSGVLEKMLRDQQGPSKKPASAVLTCPNASFTDLAEIVSRIEPAKPAMVDDESDYQTEYEEELLDVPRDAYADFQSTSAQQGSDLEDESSLRHRHPSLAFPKLSE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PNPLA7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 375775
Iso type IgG

Enviar uma mensagem


PNPLA7 polyclonal antibody

PNPLA7 polyclonal antibody