FAM49B polyclonal antibody
  • FAM49B polyclonal antibody

FAM49B polyclonal antibody

Ref: AB-PAB20472
FAM49B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM49B.
Información adicional
Size 100 uL
Gene Name FAM49B
Gene Alias BM-009|DKFZp686B04128|L1
Gene Description family with sequence similarity 49, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNVVLKDAEGILEDLQSYRGAGHEIREAIQHPADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAALRGLLGALTSTPYSPTQHLEREQALAKQFAE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM49B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51571
Iso type IgG

Enviar uma mensagem


FAM49B polyclonal antibody

FAM49B polyclonal antibody