SOX7 polyclonal antibody
  • SOX7 polyclonal antibody

SOX7 polyclonal antibody

Ref: AB-PAB20470
SOX7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SOX7.
Información adicional
Size 100 uL
Gene Name SOX7
Gene Alias MGC10895
Gene Description SRY (sex determining region Y)-box 7
Storage Conditions Store at 4C for short term storage. For long term storage, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq SPLHCSHPLGSLALGQSPGVSMMSPVPGCPPSPAYYSPATYHPLHSNLQAHLGQLSPPPEHPGFDALDQLSQVELLGDMDRNEFDQYLNTPGHPDSATGAMALSGHVPVSQVTPTGPTETSLISVLADATATYYNSYS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (0.04-0.4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SOX7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 83595
Iso type IgG

Enviar uma mensagem


SOX7 polyclonal antibody

SOX7 polyclonal antibody