GALNT5 polyclonal antibody
  • GALNT5 polyclonal antibody

GALNT5 polyclonal antibody

Ref: AB-PAB20467
GALNT5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GALNT5.
Información adicional
Size 100 uL
Gene Name GALNT5
Gene Alias GALNAC-T5|MGC165041
Gene Description UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 5 (GalNAc-T5)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MKPPLRGHGKGAWGKENVRKTEESVLKVEVDLDQTQRERKMQNALGRGKVVPLWHPAHLQTLPVTPNKQKTDGRGTKPEASSHQGTPKQTTAQGAPKTSFIAAKGTQVVKISVHMGRVSLKQEPR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GALNT5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11227
Iso type IgG

Enviar uma mensagem


GALNT5 polyclonal antibody

GALNT5 polyclonal antibody