GPR125 polyclonal antibody
  • GPR125 polyclonal antibody

GPR125 polyclonal antibody

Ref: AB-PAB20460
GPR125 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GPR125.
Información adicional
Size 100 uL
Gene Name GPR125
Gene Alias PGR21|TEM5L
Gene Description G protein-coupled receptor 125
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DIFRGLTNLVRLNLSGNLFSSLSQGTFDYLASLRSLEFQTEYLLCDCNILWMHRWVKEKNITVRDTRCVYPKSLQAQPVTGVKQELLTCDPPLELPSFYMTPSHRQVVFEGDSLPFQCMASYIDQDMQVLWYQDGRI
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GPR125.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 166647
Iso type IgG

Enviar uma mensagem


GPR125 polyclonal antibody

GPR125 polyclonal antibody