URB2 polyclonal antibody
  • URB2 polyclonal antibody

URB2 polyclonal antibody

Ref: AB-PAB20458
URB2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant URB2.
Información adicional
Size 100 uL
Gene Name URB2
Gene Alias KIAA0133|MGC138837|MGC138838|NPA2
Gene Description URB2 ribosome biogenesis 2 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VLGPFLKEQKLGQEAPAALSELLQQVVLQTGAVLQLCSVPGARGWRLPSVLISSVSTLLEADLGQHCRDGGADISQGSDRTLLSHVALYQGVYSQILLELPALAGHDQSFQAALQFLTLFFLAPELHPKKDSVFTSMFHS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human URB2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9816
Iso type IgG

Enviar uma mensagem


URB2 polyclonal antibody

URB2 polyclonal antibody