CCNB2 polyclonal antibody
  • CCNB2 polyclonal antibody

CCNB2 polyclonal antibody

Ref: AB-PAB20456
CCNB2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCNB2.
Información adicional
Size 100 uL
Gene Name CCNB2
Gene Alias HsT17299
Gene Description cyclin B2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLC
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCNB2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9133
Iso type IgG

Enviar uma mensagem


CCNB2 polyclonal antibody

CCNB2 polyclonal antibody