GRAMD1A polyclonal antibody
  • GRAMD1A polyclonal antibody

GRAMD1A polyclonal antibody

Ref: AB-PAB20454
GRAMD1A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GRAMD1A.
Información adicional
Size 100 uL
Gene Name GRAMD1A
Gene Alias FLJ22411|FLJ90346|KIAA1533
Gene Description GRAM domain containing 1A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SEDEDYVSPLQLNGLGTPKEVGDVIALSDITSSGAADRSQEPSPVGSRRGHVTPNLSRASSDADHGAEEDKEEQVDSQPDASSSQTVTPVAEPPSTEPTQPDGPTTLGPLDLLPS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GRAMD1A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57655
Iso type IgG

Enviar uma mensagem


GRAMD1A polyclonal antibody

GRAMD1A polyclonal antibody