SFRS11 polyclonal antibody
  • SFRS11 polyclonal antibody

SFRS11 polyclonal antibody

Ref: AB-PAB20446
SFRS11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SFRS11.
Información adicional
Size 100 uL
Gene Name SFRS11
Gene Alias DKFZp686M13204|dJ677H15.2|p54
Gene Description splicing factor, arginine/serine-rich 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LLPTPNPLTQIGAVPLAALGAPTLDPALAALGLPGANLNSQSLAADQLLKLMSTVDPKLNHVAAGLVSPSLKSDTSSKEIEEAMKRVREAQSLISAAIEPDKKEEKRRHSRSRSR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SFRS11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9295
Iso type IgG

Enviar uma mensagem


SFRS11 polyclonal antibody

SFRS11 polyclonal antibody