TMF1 polyclonal antibody
  • TMF1 polyclonal antibody

TMF1 polyclonal antibody

Ref: AB-PAB20445
TMF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMF1.
Información adicional
Size 100 uL
Gene Name TMF1
Gene Alias ARA160
Gene Description TATA element modulatory factor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq TSTTSDIEVLDHESVISESSASSRQETTDSKSSLHLMQTSFQLLSASACPEYNRLDDFQKLTESCCSSDAFERIDSFSVQSLDSRSVSEINSDDELSGKGYALVPIIVNSSTPKSKTVESAEGKSEEVNETLVIPTEEAEMEESG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7110
Iso type IgG

Enviar uma mensagem


TMF1 polyclonal antibody

TMF1 polyclonal antibody