ZNF132 polyclonal antibody
  • ZNF132 polyclonal antibody

ZNF132 polyclonal antibody

Ref: AB-PAB20444
ZNF132 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF132.
Información adicional
Size 100 uL
Gene Name ZNF132
Gene Alias MGC126390|MGC126391|pHZ-12
Gene Description zinc finger protein 132
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EHQGTQSEEKPYTCGACGRDFWLNANLHQHQKEHSGGKPFRWYKDRDALMKSSKVHLSENPFTCREGGKVILGSCDLLQLQAVDSGQKPYSNLGQLPEVCTTQKLFECSNCGKAFLKSSTLPNHLRTHSE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF132.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7691
Iso type IgG

Enviar uma mensagem


ZNF132 polyclonal antibody

ZNF132 polyclonal antibody