CSMD2 polyclonal antibody
  • CSMD2 polyclonal antibody

CSMD2 polyclonal antibody

Ref: AB-PAB20442
CSMD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CSMD2.
Información adicional
Size 100 uL
Gene Name CSMD2
Gene Alias KIAA1884|dJ1007G16.1|dJ1007G16.2|dJ947L8.1
Gene Description CUB and Sushi multiple domains 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RYSAPYCSLPRAPLHGFILGQTSTQPGGSIHFGCNAGYRLVGHSMAICTRHPQGYHLWSEAIPLCQALSCGLPEAPKNGMVFGKEYTVGTKAMYSCSEGYHLQAGAEATAECLDTGLWSNRNVPPQCVPVTCPDVSSISVEH
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CSMD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 114784
Iso type IgG

Enviar uma mensagem


CSMD2 polyclonal antibody

CSMD2 polyclonal antibody