SLC6A15 polyclonal antibody
  • SLC6A15 polyclonal antibody

SLC6A15 polyclonal antibody

Ref: AB-PAB20440
SLC6A15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC6A15.
Información adicional
Size 100 uL
Gene Name SLC6A15
Gene Alias DKFZp761I0921|FLJ10316|MGC87066|NTT73|SBAT1|V7-3|hv7-3
Gene Description solute carrier family 6 (neutral amino acid transporter), member 15
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDERPAWNSKLQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC6A15.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55117
Iso type IgG

Enviar uma mensagem


SLC6A15 polyclonal antibody

SLC6A15 polyclonal antibody