ZNF236 polyclonal antibody
  • ZNF236 polyclonal antibody

ZNF236 polyclonal antibody

Ref: AB-PAB20439
ZNF236 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF236.
Información adicional
Size 100 uL
Gene Name ZNF236
Gene Alias ZNF236A|ZNF236B
Gene Description zinc finger protein 236
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QLQQHQQAASIDDSTVDQQSMQASTQMQVEIESDELPQTAEVVAANPEAMLDLEPQHVVGTEEAGLGQQLADQPLEADEDGFVAPQDPLRGHVDQFEEQSPAQQSFEPAGLPQGFTVTDTYHQQPQFPPVQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF236.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7776
Iso type IgG

Enviar uma mensagem


ZNF236 polyclonal antibody

ZNF236 polyclonal antibody