ZP4 polyclonal antibody
  • ZP4 polyclonal antibody

ZP4 polyclonal antibody

Ref: AB-PAB20437
ZP4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZP4.
Información adicional
Size 100 uL
Gene Name ZP4
Gene Alias ZBP|ZP1|ZPB
Gene Description zona pellucida glycoprotein 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FAVNLNQEATSPPVLIAWDNQGLLHELQNDSDCGTWIRKGPGSSVVLEATYSSCYVTEWDSHYIMPVGVEGAGAAEHKVVTERKLLKCPMDLLARDAPDTDWCDSIPA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZP4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57829
Iso type IgG

Enviar uma mensagem


ZP4 polyclonal antibody

ZP4 polyclonal antibody