LRRC47 polyclonal antibody
  • LRRC47 polyclonal antibody

LRRC47 polyclonal antibody

Ref: AB-PAB20434
LRRC47 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC47.
Información adicional
Size 100 uL
Gene Name LRRC47
Gene Alias KIAA1185
Gene Description leucine rich repeat containing 47
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PGNALKRFLTSQTKLHEDLCEKRTAATLATHELRAVKGPLLYCARPPQDLKIVPLGRKEAKAKELVRQLQLEAEEQRKQKKRQSVSGLHRYLHLLDGNENYPCLVDADGDVISFPPITNSEK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC47.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57470
Iso type IgG

Enviar uma mensagem


LRRC47 polyclonal antibody

LRRC47 polyclonal antibody