EPS15 polyclonal antibody
  • EPS15 polyclonal antibody

EPS15 polyclonal antibody

Ref: AB-PAB20429
EPS15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EPS15.
Información adicional
Size 100 uL
Gene Name EPS15
Gene Alias AF-1P|AF1P|MLLT5
Gene Description epidermal growth factor receptor pathway substrate 15
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPD
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EPS15.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2060
Iso type IgG

Enviar uma mensagem


EPS15 polyclonal antibody

EPS15 polyclonal antibody