HJURP polyclonal antibody
  • HJURP polyclonal antibody

HJURP polyclonal antibody

Ref: AB-PAB20427
HJURP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HJURP.
Información adicional
Size 100 uL
Gene Name HJURP
Gene Alias DKFZp762E1312|FAKTS|URLC9|hFLEG1
Gene Description Holliday junction recognition protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq TPVVQMATLTYETPQGLRIWGGRLIKERNEGEIQDSSMKPADRTDGSVQAAAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQSPLKNELRRKYLTQVDILLQGAEYFECAGNRAGRDVRV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HJURP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55355
Iso type IgG

Enviar uma mensagem


HJURP polyclonal antibody

HJURP polyclonal antibody