C20orf160 polyclonal antibody
  • C20orf160 polyclonal antibody

C20orf160 polyclonal antibody

Ref: AB-PAB20426
C20orf160 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C20orf160.
Información adicional
Size 100 uL
Gene Name C20orf160
Gene Alias FLJ43600|dJ310O13.5
Gene Description chromosome 20 open reading frame 160
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IRRLVFPKAGRRAACRSSVSRRPLHSMPLYPPDYLIDPQILLCDYLEKEVKFLGHLTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLLTWRDNEELILRIPTHE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C20orf160.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 140706
Iso type IgG

Enviar uma mensagem


C20orf160 polyclonal antibody

C20orf160 polyclonal antibody