GPSM2 polyclonal antibody
  • GPSM2 polyclonal antibody

GPSM2 polyclonal antibody

Ref: AB-PAB20424
GPSM2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GPSM2.
Información adicional
Size 100 uL
Gene Name GPSM2
Gene Alias LGN|Pins
Gene Description G-protein signaling modulator 2 (AGS3-like, C. elegans)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq FQSNRMDDQRCCLQEKNCHTASTTTSSTPPKMMLKTSSVPVVSPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GPSM2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29899
Iso type IgG

Enviar uma mensagem


GPSM2 polyclonal antibody

GPSM2 polyclonal antibody