ANKS6 polyclonal antibody
  • ANKS6 polyclonal antibody

ANKS6 polyclonal antibody

Ref: AB-PAB20423
ANKS6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKS6.
Información adicional
Size 100 uL
Gene Name ANKS6
Gene Alias ANKRD14|DKFZp686D24121|DKFZp781I0117|MGC70366|SAMD6
Gene Description ankyrin repeat and sterile alpha motif domain containing 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TSTTSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQSKSSGGSSSGTITDEDELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISELNAGKGRERQILQETIHNFHSSF
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKS6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 203286
Iso type IgG

Enviar uma mensagem


ANKS6 polyclonal antibody

ANKS6 polyclonal antibody