DPY19L3 polyclonal antibody
  • DPY19L3 polyclonal antibody

DPY19L3 polyclonal antibody

Ref: AB-PAB20421
DPY19L3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DPY19L3.
Información adicional
Size 100 uL
Gene Name DPY19L3
Gene Alias DKFZp686J17135|MGC35440
Gene Description dpy-19-like 3 (C. elegans)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DTVELMNWINSNTPRKAVFAGSMQLLAGVKLCTGRTLTNHPHYEDSSLRERTRAVYQIYAKRAPEEVHALLRSFGTDYVILEDSICYERRHRRGCRLRDLLDIANGHMMDGPGENDPDLKPADHPRFCEEIKRNLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DPY19L3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 147991
Iso type IgG

Enviar uma mensagem


DPY19L3 polyclonal antibody

DPY19L3 polyclonal antibody