TGFBR3 polyclonal antibody
  • TGFBR3 polyclonal antibody

TGFBR3 polyclonal antibody

Ref: AB-PAB20417
TGFBR3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TGFBR3.
Información adicional
Size 100 uL
Gene Name TGFBR3
Gene Alias BGCAN|betaglycan
Gene Description transforming growth factor, beta receptor III
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TGFBR3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7049
Iso type IgG

Enviar uma mensagem


TGFBR3 polyclonal antibody

TGFBR3 polyclonal antibody