PSMA2 polyclonal antibody
  • PSMA2 polyclonal antibody

PSMA2 polyclonal antibody

Ref: AB-PAB20412
PSMA2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PSMA2.
Información adicional
Size 100 uL
Gene Name PSMA2
Gene Alias HC3|MU|PMSA2|PSC2
Gene Description proteasome (prosome, macropain) subunit, alpha type, 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq SGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PSMA2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5683
Iso type IgG

Enviar uma mensagem


PSMA2 polyclonal antibody

PSMA2 polyclonal antibody