IL1RL1 polyclonal antibody
  • IL1RL1 polyclonal antibody

IL1RL1 polyclonal antibody

Ref: AB-PAB20396
IL1RL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IL1RL1.
Información adicional
Size 100 uL
Gene Name IL1RL1
Gene Alias DER4|FIT-1|MGC32623|ST2|ST2L|ST2V|T1
Gene Description interleukin 1 receptor-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRY
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IL1RL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9173
Iso type IgG

Enviar uma mensagem


IL1RL1 polyclonal antibody

IL1RL1 polyclonal antibody