ABCA3 polyclonal antibody
  • ABCA3 polyclonal antibody

ABCA3 polyclonal antibody

Ref: AB-PAB20394
ABCA3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ABCA3.
Información adicional
Size 100 uL
Gene Name ABCA3
Gene Alias ABC-C|ABC3|EST111653|LBM180|MGC166979|MGC72201|SMDP3
Gene Description ATP-binding cassette, sub-family A (ABC1), member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MLRLTLGEYGRTVVPFSVPGTSQLGQQLSEHLKDALQAEGQEPREVLGDLEEFLIFRASVEGGGFNERCLVAASFRDVGERTVVNALFNNQAYHSPATALAVVDNLLFKLLCGPHASIVVSNFPQPRSALQAAKDQFNEG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ABCA3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 21
Iso type IgG

Enviar uma mensagem


ABCA3 polyclonal antibody

ABCA3 polyclonal antibody