FNDC3B polyclonal antibody
  • FNDC3B polyclonal antibody

FNDC3B polyclonal antibody

Ref: AB-PAB20393
FNDC3B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FNDC3B.
Información adicional
Size 100 uL
Gene Name FNDC3B
Gene Alias DKFZp686D14170|DKFZp762K137|FAD104|FLJ23399|MGC10002|PRO4979|YVTM2421
Gene Description fibronectin type III domain containing 3B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq SIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECYPPSYPSAMSPTHHLPPYLTHHPHFIHNSHTAYYPPVTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMSTYITREDQYSK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FNDC3B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64778
Iso type IgG

Enviar uma mensagem


FNDC3B polyclonal antibody

FNDC3B polyclonal antibody