CCAR1 polyclonal antibody
  • CCAR1 polyclonal antibody

CCAR1 polyclonal antibody

Ref: AB-PAB20392
CCAR1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCAR1.
Información adicional
Size 100 uL
Gene Name CCAR1
Gene Alias CARP-1|CARP1|MGC44628|RP11-437A18.1
Gene Description cell division cycle and apoptosis regulator 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNED
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCAR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55749
Iso type IgG

Enviar uma mensagem


CCAR1 polyclonal antibody

CCAR1 polyclonal antibody