AUP1 polyclonal antibody
  • AUP1 polyclonal antibody

AUP1 polyclonal antibody

Ref: AB-PAB20389
AUP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AUP1.
Información adicional
Size 100 uL
Gene Name AUP1
Gene Alias -
Gene Description ancient ubiquitous protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LLWSLFVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AUP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 550
Iso type IgG

Enviar uma mensagem


AUP1 polyclonal antibody

AUP1 polyclonal antibody