HECW1 polyclonal antibody
  • HECW1 polyclonal antibody

HECW1 polyclonal antibody

Ref: AB-PAB20386
HECW1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HECW1.
Información adicional
Size 100 uL
Gene Name HECW1
Gene Alias KIAA0322|NEDL1
Gene Description HECT, C2 and WW domain containing E3 ubiquitin protein ligase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq STEPESAQIQDSPMNNLMESGSGEPRSEAPESSESWKPEQLGEGSVPDGPGNQSIELSRPAEEAAVITEAGDQGMVSVGPEGAGELLAQVQKDIQPAPSAEELAEQLDLGEEASALLLEDGEAPAS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HECW1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23072
Iso type IgG

Enviar uma mensagem


HECW1 polyclonal antibody

HECW1 polyclonal antibody