XYLT1 polyclonal antibody
  • XYLT1 polyclonal antibody

XYLT1 polyclonal antibody

Ref: AB-PAB20380
XYLT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant XYLT1.
Información adicional
Size 100 uL
Gene Name XYLT1
Gene Alias XT-I|XT1
Gene Description xylosyltransferase I
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VWTVKILHHWVPVAETKFLVAPLTFSNRQPIKPEEALKLHNGPLRNAYMEQSFQSLNPVLSLPINPAQVEQARRNAASTGTALEGWLDSLVGGMWTAMDICATGPTACPVMQTCSQTAWSSFSPDPKSELG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human XYLT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64131
Iso type IgG

Enviar uma mensagem


XYLT1 polyclonal antibody

XYLT1 polyclonal antibody