TCTA polyclonal antibody
  • TCTA polyclonal antibody

TCTA polyclonal antibody

Ref: AB-PAB20376
TCTA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TCTA.
Información adicional
Size 100 uL
Gene Name TCTA
Gene Alias -
Gene Description T-cell leukemia translocation altered gene
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TCTA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6988
Iso type IgG

Enviar uma mensagem


TCTA polyclonal antibody

TCTA polyclonal antibody