CALB2 polyclonal antibody
  • CALB2 polyclonal antibody

CALB2 polyclonal antibody

Ref: AB-PAB20373
CALB2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CALB2.
Información adicional
Size 100 uL
Gene Name CALB2
Gene Alias CAL2
Gene Description calbindin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CALB2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 794
Iso type IgG

Enviar uma mensagem


CALB2 polyclonal antibody

CALB2 polyclonal antibody