SPINK4 polyclonal antibody
  • SPINK4 polyclonal antibody

SPINK4 polyclonal antibody

Ref: AB-PAB20369
SPINK4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPINK4.
Información adicional
Size 100 uL
Gene Name SPINK4
Gene Alias MGC133107|PEC-60
Gene Description serine peptidase inhibitor, Kazal type 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LPFSRMPICEHMVESPTCSQMSNLVCGTDGLTYTNECQLCLARIKTKQDIQIMKDGK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPINK4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27290
Iso type IgG

Enviar uma mensagem


SPINK4 polyclonal antibody

SPINK4 polyclonal antibody