SCAND3 polyclonal antibody
  • SCAND3 polyclonal antibody

SCAND3 polyclonal antibody

Ref: AB-PAB20368
SCAND3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SCAND3.
Información adicional
Size 100 uL
Gene Name SCAND3
Gene Alias DKFZp434N092|FLJ31087|KIAA1925|MGC131782|MGC133310|MGC133311|ZFP38-L|ZNF305P2|ZNF452|dJ1186N24.3
Gene Description SCAN domain containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SAFSSEAKLGLSHSQLTEELVASLHTENELDQADKELENTLRAQYEENIETGTDSSDIEENLSVTPKVAEKSPPESRLRFLSCVVCEKECTGVNSCISCDGNIHAICGVPSQHGTEGCGRQITCSLCYETSTMK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SCAND3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 114821
Iso type IgG

Enviar uma mensagem


SCAND3 polyclonal antibody

SCAND3 polyclonal antibody