CDH9 polyclonal antibody
  • CDH9 polyclonal antibody

CDH9 polyclonal antibody

Ref: AB-PAB20362
CDH9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CDH9.
Información adicional
Size 100 uL
Gene Name CDH9
Gene Alias MGC125386
Gene Description cadherin 9, type 2 (T1-cadherin)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GIITVKQNLDFENQMLYTLRVDASNTHPDPRFLHLGPFKDTAVVKISVEDIDEPPVFTKVSYLIEVDEDVKEGSIIGQVTAYDPDARNNLIKYSVDRHTDMDRI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CDH9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1007
Iso type IgG

Enviar uma mensagem


CDH9 polyclonal antibody

CDH9 polyclonal antibody