TAF5 polyclonal antibody
  • TAF5 polyclonal antibody

TAF5 polyclonal antibody

Ref: AB-PAB20350
TAF5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TAF5.
Información adicional
Size 100 uL
Gene Name TAF5
Gene Alias TAF2D|TAFII100
Gene Description TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq IVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPKKKKPKKDSIGSKSKKQDPNAPPQNRIPLPELKDSDKLDKIMNMKETTK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TAF5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6877
Iso type IgG

Enviar uma mensagem


TAF5 polyclonal antibody

TAF5 polyclonal antibody