EMX1 polyclonal antibody
  • EMX1 polyclonal antibody

EMX1 polyclonal antibody

Ref: AB-PAB20349
EMX1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EMX1.
Información adicional
Size 100 uL
Gene Name EMX1
Gene Alias -
Gene Description empty spiracles homeobox 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRI
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EMX1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2016
Iso type IgG

Enviar uma mensagem


EMX1 polyclonal antibody

EMX1 polyclonal antibody