FAM213B polyclonal antibody
  • FAM213B polyclonal antibody

FAM213B polyclonal antibody

Ref: AB-PAB20347
FAM213B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM213B.
Información adicional
Size 100 uL
Gene Name FAM213B
Gene Alias RP3-395M20.10|C1orf93
Gene Description family with sequence similarity 213, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LAGLLDQHGVRLVGVGPEALGLQEFLDGDYFAGELYLDESKQLYKELGFKRYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM213B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 127281
Iso type IgG

Enviar uma mensagem


FAM213B polyclonal antibody

FAM213B polyclonal antibody