HCFC2 polyclonal antibody
  • HCFC2 polyclonal antibody

HCFC2 polyclonal antibody

Ref: AB-PAB20343
HCFC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HCFC2.
Información adicional
Size 100 uL
Gene Name HCFC2
Gene Alias FLJ94012|HCF-2|HCF2
Gene Description host cell factor C2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq APSQVQLIKATTNSFHVKWDEVSTVEGYLLQLSTDLPYQAASSDSSAAPNMQGVRMDPHRQGSNNIVPNSINDTINSTKTEQPATKETSMKNKPDFKALTDSNAILYPSLASNASNHNSHVVDMLRKNEGPHTSANVGV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HCFC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29915
Iso type IgG

Enviar uma mensagem


HCFC2 polyclonal antibody

HCFC2 polyclonal antibody