MTA2 polyclonal antibody
  • MTA2 polyclonal antibody

MTA2 polyclonal antibody

Ref: AB-PAB20342
MTA2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MTA2.
Información adicional
Size 100 uL
Gene Name MTA2
Gene Alias DKFZp686F2281|MTA1L1|PID
Gene Description metastasis associated 1 family, member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq ECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MTA2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9219
Iso type IgG

Enviar uma mensagem


MTA2 polyclonal antibody

MTA2 polyclonal antibody