MTIF2 polyclonal antibody
  • MTIF2 polyclonal antibody

MTIF2 polyclonal antibody

Ref: AB-PAB20335
MTIF2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MTIF2.
Información adicional
Size 100 uL
Gene Name MTIF2
Gene Alias -
Gene Description mitochondrial translational initiation factor 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq RKEQIPLKPKEKRERDSNVLSVIIKGDVDGSVEAILNIIDTYDASHECELELVHFGVGDISANDVNLAETFDGVIYGFNVNAGNVIQQSAAKKGVKIKLHKIIYRLVEDLQEELSSRLPCAVEEHPVGEASILATFSVTEGKKKVPVAGC
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MTIF2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4528
Iso type IgG

Enviar uma mensagem


MTIF2 polyclonal antibody

MTIF2 polyclonal antibody