MYOM2 polyclonal antibody
  • MYOM2 polyclonal antibody

MYOM2 polyclonal antibody

Ref: AB-PAB20328
MYOM2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MYOM2.
Información adicional
Size 100 uL
Gene Name MYOM2
Gene Alias TTNAP
Gene Description myomesin (M-protein) 2, 165kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MYOM2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9172
Iso type IgG

Enviar uma mensagem


MYOM2 polyclonal antibody

MYOM2 polyclonal antibody