EMCN polyclonal antibody
  • EMCN polyclonal antibody

EMCN polyclonal antibody

Ref: AB-PAB20327
EMCN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EMCN.
Información adicional
Size 100 uL
Gene Name EMCN
Gene Alias EMCN2|MUC14
Gene Description endomucin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EMCN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51705
Iso type IgG

Enviar uma mensagem


EMCN polyclonal antibody

EMCN polyclonal antibody